General Information

  • ID:  hor005227
  • Uniprot ID:  P01259
  • Protein name:  Calcitonin
  • Gene name:  CALCA
  • Organism:  Sus scrofa (Pig)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP
  • Length:  32(1-32)
  • Propeptide:  CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP
  • Signal peptide:  NA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RAMP1
  • Target Unid:   Q867C0
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45664
  • Structure ID:  AF-P01259-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01259-F1.pdbhor005227_AF2.pdbhor005227_ESM.pdb

Physical Information

Mass: 416015 Formula: C159H233N45O46S3
Absent amino acids: DIKQ Common amino acids: NS
pI: 8.23 Basic residues: 3
Polar residues: 16 Hydrophobic residues: 9
Hydrophobicity: -25.63 Boman Index: -4714
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 48.75
Instability Index: 868.13 Extinction Coefficient cystines: 7115
Absorbance 280nm: 229.52

Literature

  • PubMed ID:  5240032
  • Title:  The amino acid sequence of porcine thyrocalcitonin.
  • PubMed ID:  5462122
  • Title:  Degradation and structure of porcine calcitonin-1.
  • PubMed ID:  5693288
  • Title:  Thyrocalcitonin. II. Structure of alpha-thyrocalcitonin.